Size of this PNG preview of this SVG file: 800 × 320 pixels. Other resolutions: 320 × 128 pixels | 640 × 256 pixels | 1,024 × 410 pixels | 1,280 × 512 pixels | 2,560 × 1,024 pixels | 2,400 × 960 pixels.
Original file (SVG file, nominally 2,400 × 960 pixels, file size: 151 KB)
File history
Click on a date/time to view the file as it appeared at that time.
| Date/Time | Thumbnail | Dimensions | User | Comment | |
|---|---|---|---|---|---|
| current | 19:34, 18 May 2025 | 2,400 × 960 (151 KB) | Master Uegly | {{Information |description={{en|1=beta-Endorphin (β-endorphin) is an endogenous opioid neuropeptide and peptide hormone that is produced in certain neurons within the central nervous system and peripheral nervous system. It is one of three endorphins that are produced in humans, the others of which include α-endorphin and γ-endorphin. SEQUENCE: monogramatic YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE trigramatic Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-I... |
File usage
The following 2 pages use this file:
Global file usage
The following other wikis use this file:
- Usage on ur.wikipedia.org