File:Beta endorphin unlabeled.svg

Original file (SVG file, nominally 2,400 × 960 pixels, file size: 151 KB)

Summary

Description
English: beta-Endorphin (β-endorphin) is an endogenous opioid neuropeptide and peptide hormone that is produced in certain neurons within the central nervous system and peripheral nervous system. It is one of three endorphins that are produced in humans, the others of which include α-endorphin and γ-endorphin.

SEQUENCE:

monogramatic

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

trigramatic

Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu
Date
Source Own work, recreation of Beta-endorphin.png using Beta endorphin AA label.svg
Author
Permission
(Reusing this file)
I, the copyright holder of this work, hereby publish it under the following license:
w:en:Creative Commons
attribution share alike
This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.
You are free:
  • to share – to copy, distribute and transmit the work
  • to remix – to adapt the work
Under the following conditions:
  • attribution – You must give appropriate credit, provide a link to the license, and indicate if changes were made. You may do so in any reasonable manner, but not in any way that suggests the licensor endorses you or your use.
  • share alike – If you remix, transform, or build upon the material, you must distribute your contributions under the same or compatible license as the original.

Captions

Add a one-line explanation of what this file represents

Items portrayed in this file

depicts

18 May 2025

154,946 byte

image/svg+xml

f83f05f683cabad340a6f205ceec1e9f773d9905

File history

Click on a date/time to view the file as it appeared at that time.

Date/TimeThumbnailDimensionsUserComment
current19:34, 18 May 2025Thumbnail for version as of 19:34, 18 May 20252,400 × 960 (151 KB)Master Uegly{{Information |description={{en|1=beta-Endorphin (β-endorphin) is an endogenous opioid neuropeptide and peptide hormone that is produced in certain neurons within the central nervous system and peripheral nervous system. It is one of three endorphins that are produced in humans, the others of which include α-endorphin and γ-endorphin. SEQUENCE: monogramatic YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE trigramatic Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-I...

The following 2 pages use this file:

Global file usage

The following other wikis use this file:

Metadata